missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TULP4 Partial ORF (NP_001007467.1, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00056995-Q01.10ug

Detalles adicionales : Weight : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16138926

  • 4130.00 NOK / 10µg
Estimated Shipment: 25-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Descripción

Descripción

Sequence: MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLAT
Especificaciones

Especificaciones

NP_001007467.1
Liquid
56995
TULP4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA1397/TUSP
TULP4
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLAT
RUO
TULP4
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Product Certifications
Ofertas especiales

Ofertas especiales