missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TSPAN9 Full-length ORF (AAH34280.1, 1 a.a. - 157 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010867-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135772

  • 5420.23 NOK / 25µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq]

Sequence: MWGRPTFEQSCPALVPWPGFLVRSFSRLRRNPQSADSGADTSGRRDSADKCCSCTVGPGASCVFCCGWGGWVGLCLSMQFLIFVNINSKSLVHWEMCNLPENLFCFWSTSGVASGPRAFATVLPPAPTSSVCLQSLIYRSPRCLLYSLCAWPFCYLA
Specifications

Specifications

AAH34280.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.6kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NET-5/PP1057
TSPAN9
Yes
wheat germ expression system
Liquid
10867
TSPAN9 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MWGRPTFEQSCPALVPWPGFLVRSFSRLRRNPQSADSGADTSGRRDSADKCCSCTVGPGASCVFCCGWGGWVGLCLSMQFLIFVNINSKSLVHWEMCNLPENLFCFWSTSGVASGPRAFATVLPPAPTSSVCLQSLIYRSPRCLLYSLCAWPFCYLA
RUO
TSPAN9
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates