missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TRIM71 (aa 472-546) Control Fragment Recombinant Protein

Product Code. 30202258
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202258 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202258 Supplier Invitrogen™ Supplier No. RP96487

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58265 (PA5-58265. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRIM71 is the mammalian ortholog to the C. elegans heterochronic protein Lin41, a protein that is thought to be important in postembryonic development, and is genetically and biochemically downstream of both Shh and Fgf signaling pathways. Similar to its C. elegans homolog, TRIM71 is a target of the microRNA let-7 and is likely to play a role in mammalian development. Recent experiments have indicated that TRIM71 is an E3 ubiquitin ligase and can interact with the Dicer and the Argonaute proteins Ago1, Ago2, and Ago4. Overexpression and depletion of TRIM71 led to inverse changes in Ago2 protein levels, suggesting TRIM71 can regulate Ago2 turnover. Finally, TRIM71 cooperates with the pluripotency factor Lin-28 in regulating let-7.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q2Q1W2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 131405
Name Human TRIM71 (aa 472-546) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610206G21Rik; abnormal cell LINeage LIN-41; AL022943; B-box zinc finger, Filamin and NHL repeat containing protein (123.8 kD) (lin-41); Drosophila dappled/ vertebrate TRipartite Motif protein related; E3 ubiquitin-protein ligase TRIM71; Gm1127; homolog of C. elegans Lin-41; Lin41; LIN-41; lin-41 homolog; mLin41; mlin-41; protein lin-41 homolog; RGD1566388; RING-type E3 ubiquitin transferase TRIM71; Trim71; tripartite motif containing 71; tripartite motif containing 71, E3 ubiquitin protein ligase; tripartite motif-containing 71; tripartite motif-containing protein 71
Common Name TRIM71
Gene Symbol TRIM71
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKSFGFVSSGAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVSDQQNG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.