Learn More
Abnova™ Human TRAM2 Partial ORF (NP_036420, 310 a.a. - 369 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009697-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.[supplied by OMIM]
Sequence: FIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKSSpecifications
NP_036420 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.34kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
FIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKS | |
RUO | |
TRAM2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
9697 | |
TRAM2 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KIAA0057 | |
TRAM2 | |
Recombinant | |
wheat germ expression system |