missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TOP1 Partial ORF (NP_003277, 692 a.a. - 765 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007150-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22. [provided by RefSeq]
Sequence: QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEFSpecifications
| NP_003277 | |
| Liquid | |
| 7150 | |
| TOP1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TOPI | |
| TOP1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.88kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF | |
| RUO | |
| TOP1 | |
| Wheat Germ (in vitro) | |
| GST |