missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TIMM17A Full-length ORF (NP_006326.1, 1 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human TIMM17A Full-length ORF (NP_006326.1, 1 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16195092
Price: 6245.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00010440-P01.25ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16195092

6245.00 NOK / 25µg

Estimated Shipment: 01-07-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Descrizione

Sequence: MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

Specifica

Accession Number	NP_006326.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	44.4kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	TIM17/TIM17A
Gene Symbol	TIMM17A
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	10440
Name	TIMM17A (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
Regulatory Status	RUO
Common Name	TIMM17A
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Suggerimenti di prodotto

Abnova™ Human TIMM17A Full-length ORF (NP_006326.1, 1 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal

Descrizione

Specifica

Suggerimenti di prodotto

Documenti

Offerte speciali