missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TGFA Partial ORF (NP_003227, 42 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007039-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16196555

  • 4115.00 NOK / 10µg
Estimated Shipment: 19-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Transforming growth factors (TGFs) are biologically active polypeptides that reversibly confer the transformed phenotype on cultured cells. TGF-alpha shows about 40% sequence homology with epidermal growth factor (EGF; MIM 131530) and competes with EGF for binding to the EGF receptor (MIM 131550), stimulating its phosphorylation and producing a mitogenic response.[supplied by OMIM]

Sequence: SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
Specifications

Specifications

NP_003227
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.02kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
RUO
TGFA
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
7039
TGFA (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TFGA
TGFA
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers