Learn More
Abnova™ Human TEAD4 Partial ORF (NP_003204, 151 a.a. - 260 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00007004-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq]
Sequence: ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPSpecifications
NP_003204 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.84kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP | |
RUO | |
TEAD4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
7004 | |
TEAD4 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
EFTR-2/MGC9014/RTEF1/TCF13L1/TEF-3/TEFR-1/hRTEF-1B | |
TEAD4 | |
Recombinant | |
wheat germ expression system |