missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SPOCK3 Partial ORF (NP_058646, 132 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00050859-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136486

  • 3602.46 NOK / 10µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.[supplied by OMIM]

Sequence: RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT
Specifications

Specifications

NP_058646
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT
RUO
SPOCK3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
50859
SPOCK3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HSAJ1454/TES-3
SPOCK3
Yes
Videos
SDS
Documents
Certificates