missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SMA4 Full-length ORF (AAI71739.1, 1 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00011039-P02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16126062

  • 4115.00 NOK / 10µg
Estimated Shipment: 17-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Specifications

Specifications

AAI71739.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41.9kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ36702/MGC22265/MGC60382/SMA3/b55C20.2
SMA4
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
11039
SMA4 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
RUO
SMA4
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers