missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC25A23 Partial ORF (NP_077008.2, 2 a.a. - 74 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00079085-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139926

  • 3602.46 NOK / 10µg

Estimated Shipment: 20-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRY
Specifications

Specifications

NP_077008.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.77kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRY
RUO
SLC25A23
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79085
SLC25A23 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APC2/MCSC2/MGC2615/SCaMC-3
SLC25A23
Yes
Videos
SDS
Documents
Certificates