missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC25A13 Partial ORF (NP_055066, 2 a.a. - 80 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010165-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of the mitochondrial carrier family. The encoded protein contains four EF-hand Ca(2+) binding motifs in the N-terminal domain, and localizes to mitochondria. The protein catalyzes the exchange of aspartate for glutamate and a proton across the inner mitochondrial membrane, and is stimulated by calcium on the external side of the inner mitochondrial membrane. Mutations in this gene result in citrullinemia, type II. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVASpecifications
| NP_055066 | |
| Liquid | |
| 10165 | |
| SLC25A13 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ARALAR2/CITRIN/CTLN2 | |
| SLC25A13 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.43kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVA | |
| RUO | |
| SLC25A13 | |
| Wheat Germ (in vitro) | |
| GST |