missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC22A9 Partial ORF (NP_543142.2, 40 a.a. - 145 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00114571-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16121397

  • 6245.00 NOK / 25µg

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: FTAFIPGHRCWVHILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLT
Specifications

Specifications

NP_543142.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.4kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FTAFIPGHRCWVHILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLT
RUO
SLC22A9
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
114571
SLC22A9 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ23666/HOAT4/OAT4/OAT7/UST3H/ust3
SLC22A9
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers