missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC1A2 Partial ORF (NP_004162, 160 a.a. - 239 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006506-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq]
Sequence: DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGSpecifications
| NP_004162 | |
| Liquid | |
| 6506 | |
| SLC1A2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EAAT2/GLT-1 | |
| SLC1A2 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.54kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG | |
| RUO | |
| SLC1A2 | |
| Wheat Germ (in vitro) | |
| GST |