missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC14A2 Partial ORF (NP_009094, 40 a.a. - 128 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00008170-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
In mammalian cells, urea is the chief end-product of nitrogen catabolism and plays an important role in the urinary concentration mechanism. Thus, the plasma membrane of erythrocytes and some renal epithelial cells exhibit an elevated urea permeability that is mediated by highly selective urea transporters. In mammals, 2 urea transporters have been identified: the renal tubular urea transporter, UT2, and the erythrocyte urea transporter, UT11 (SLC14A1; MIM 111000).[supplied by OMIM]
Sequence: ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQSpecifications
| NP_009094 | |
| Liquid | |
| 8170 | |
| SLC14A2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ16167/HUT2/MGC119566/MGC119567/UT-A2/UT2/UTA/UTR/hUT-A6 | |
| SLC14A2 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.53kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ | |
| RUO | |
| SLC14A2 | |
| Wheat Germ (in vitro) | |
| GST |