missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC13A5 Partial ORF (NP_808218, 152 a.a. - 206 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00284111-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142727

  • 4130.00 NOK / 10µg
Estimated Shipment: 29-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

SLC13A5 is a tricarboxylate plasma transporter with a preference for citrate.[supplied by OMIM]

Sequence: VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK
Specifications

Specifications

NP_808218
Liquid
284111
SLC13A5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686E17257/MGC138356/NACT
SLC13A5
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.79kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK
RUO
SLC13A5
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers