missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SHOX2 Partial ORF (NP_006875, 117 a.a. - 204 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006474-Q01.10ug

Additional Details : Weight : 0.00010kg

 Afficher plus de versions de ce produit

Code produit. 16195245

  • 4115.00 NOK / 10µg
Estimated Shipment: 17-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the homeobox family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeobox genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeobox genes. This locus represents a pseudoautosomal homeobox gene that is thought to be responsible for idiopathic short stature, and it is implicated in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Spécification

Spécification

NP_006875
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.42kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
RUO
SHOX2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
6474
SHOX2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OG12/OG12X/OGI2X/SHOT
SHOX2
Recombinant
wheat germ expression system
Recommandations

Recommandations

Vidéos
FDS
Documents

Documents

Certificats
Promotions

Promotions