missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SCN8A Partial ORF (NP_055006, 1854 a.a. - 1951 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006334-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells (Plummer et al., 1998 [PubMed 9828131]).[supplied by OMIM]
Sequence: RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVTSpecifications
| NP_055006 | |
| Liquid | |
| 6334 | |
| SCN8A (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CerIII/MED/NaCh6/Nav1.6/PN4 | |
| SCN8A | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.52kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| RVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVT | |
| RUO | |
| SCN8A | |
| Wheat Germ (in vitro) | |
| GST |