missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPS6KB2 Partial ORF (AAH06106, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006199-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134695

  • 5420.23 NOK / 25µg

Estimated Shipment: 20-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq]

Sequence: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV
Specifications

Specifications

AAH06106
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV
RUO
RPS6KB2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6199
RPS6KB2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KLS/P70-beta/P70-beta-1/P70-beta-2/S6K-beta2/S6K2/SRK/STK14B/p70(S6K)-beta/p70S6Kb
RPS6KB2
Yes
Videos
SDS
Documents
Certificates