missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RNF166 Partial ORF (NP_849163.1, 19 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00115992-Q01.25ug

Weitere Details : Weight : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16121507

  • 6245.00 NOK / 25µg
Estimated Shipment: 17-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Beschreibung

Beschreibung

Sequence: GPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMAN
Spezifikation

Spezifikation

NP_849163.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMAN
RUO
RNF166
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
115992
RNF166 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC14381/MGC2647
RNF166
Recombinant
wheat germ expression system
Produktvorschläge

Produktvorschläge

Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote