missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RNF10 Partial ORF (NP_055683, 713 a.a. - 811 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009921-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16121456

  • 6245.00 NOK / 25µg
Estimated Shipment: 23-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known. [provided by RefSeq]

Sequence: AQMLRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK
Specifications

Specifications

NP_055683
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AQMLRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSEEKGGKKRKKQKQKLLFSTSVVHTK
RUO
RNF10
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
9921
RNF10 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0262/MGC126758/MGC126764/RIE2
RNF10
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers