missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RALB Partial ORF (AAH18163, 89 a.a. - 183 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005899-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134085

  • 3602.46 NOK / 10µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a GTP-binding protein that belongs to the small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. [provided by RefSeq]

Sequence: FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE
Specifications

Specifications

AAH18163
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.08kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSE
RUO
RALB
Yes
wheat germ expression system
Liquid
5899
RALB (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RALB
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates