missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PROC Partial ORF (AAH34377, 32 a.a. - 131 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00005624-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The PROC gene encodes protein C (EC 3.4.21.69), a vitamin K-dependent plasma glycoprotein that is a key component of the anticoagulant system. Protein C is cleaved to its activated form, 'activated protein C' (APC) on endothelial cells by the thrombin-thrombomodulin complex (MIM 176930; MIM 188040) and then acts as a serine protease to degrade the activated forms of coagulation factors V (F5; MIM 612309) and VIII (F8; see MIM 306700). Protein S (PROS1; MIM 176880), also a vitamin K-dependent plasma protein, functions as a cofactor to activated protein C.[supplied by OMIM]
Sequence: RAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCSpecifications
| AAH34377 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.41kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| RAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFC | |
| RUO | |
| PROC | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5624 | |
| PROC (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PC/PROC1 | |
| PROC | |
| Recombinant | |
| wheat germ expression system |