missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PRAC Full-length ORF (NP_115767.1, 1 a.a. - 57 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00084366-P01.10ug
This item is not returnable.
View return policy
Description
This gene is reported to be specifically expressed in prostate, rectum and distal colon. Sequence analysis suggests that it may play a regulatory role in the nucleus. [provided by RefSeq]
Sequence: MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIPSpecifications
NP_115767.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.4kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C17orf92/MGC32520 | |
PRAC | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
84366 | |
PRAC (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP | |
RUO | |
PRAC | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction