Learn More
Abnova™ Human PPP1R10 Partial ORF (NP_002705.2, 1 a.a. - 83 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00005514-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a protein with similarity to a rat protein that has an inhibitory effect on protein phosphatase-1 (PP1). The rat protein localizes to the nucleus and colocalizes with chromatin at distinct phases during mitosis. This gene lies within the major histocompatibility complex class I region on chromosome 6. [provided by RefSeq]
Sequence: MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSKSpecifications
NP_002705.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.87kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK | |
RUO | |
PPP1R10 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
5514 | |
PPP1R10 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CAT53/FB19/PNUTS/PP1R10 | |
PPP1R10 | |
Recombinant | |
wheat germ expression system |