missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human POU6F2 Partial ORF (NP_009183, 2 a.a. - 87 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00011281-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16126492

  • 6245.00 NOK / 25µg
Estimated Shipment: 13-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

POU6F2 is a member of a gene family characterized by the presence of a bipartite DNA-binding domain, consisting of a POU-specific domain and a POU heterodomain, separated by a variable polylinker. POU domain family members are transcriptional regulators, many of which show highly restricted patterns of expression and are known to control cell type-specific differentiation pathways (see review by Phillips and Luisi, 2000 [PubMed 11183772]).[supplied by OMIM]

Sequence: IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP
Specifications

Specifications

NP_009183
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.2kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP
RUO
POU6F2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
11281
POU6F2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RPF-1/WT5/WTSL
POU6F2
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers