missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human POLS Partial ORF (NP_008930, 2 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00011044-Q01.25ug

Additional Details : Weight : 0.00010kg


 View more versions of this product

Product Code. 16136072

  • 5318.90 NOK / 25µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion. [provided by RefSeq]

Sequence: SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
Specifications

Specifications

NP_008930
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
RUO
POLS
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
11044
POLS (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LAK-1/POLK/TRF4/TRF4-1
POLS
Yes
Videos
Safety and Handling

Safety and Handling

Product Identifier
  • POLS (human) recombinant protein (Q01)

Signal Word
  • Warning

Hazard Category
  • Acute toxicity Category 4
  • Serious eye damage/eye irritation Category 2

Hazard Statement
  • H302-Harmful if swallowed.
  • H312-Harmful in contact with skin.
  • H319-Causes serious eye irritation.

Precautionary Statement
  • P102-Keep out of reach of children.
  • P103-Read label before use.
  • P233-Keep container tightly closed.
  • P264-Wash hands thoroughly after handling.
  • P270-Do not eat, drink or smoke when using this product.
  • P280-Wear protective gloves/protective clothing/eye protection/face protection.
  • P404-Store in a closed container.

Supplemental information
  • MIXTURE LIST-Contains : tris-HCl

SDS
Documents
Certificates