missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human POLR2K Full-length ORF (AAH18157, 1 a.a. - 58 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00005440-P01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq]
Sequence: MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLAVFDARSpecifications
| AAH18157 | |
| Liquid | |
| 5440 | |
| POLR2K (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLAVFDAR | |
| RUO | |
| POLR2K | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.12kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ABC10-alpha/RPABC4/RPB10alpha/RPB12/RPB7.0/hRPB7.0/hsRPB10a | |
| POLR2K | |
| Yes | |
| wheat germ expression system |