missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PIGW Partial ORF (NP_848612.2, 399 a.a. - 447 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00284098-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]).[supplied by OMIM]
Sequence: KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRKSpecifications
| NP_848612.2 | |
| Liquid | |
| 284098 | |
| PIGW (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ37433/Gwt1 | |
| PIGW | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.13kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK | |
| RUO | |
| PIGW | |
| Wheat Germ (in vitro) | |
| GST |