missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PHF5A Full-length ORF (NP_116147, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084844-P02.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16196103

  • 5540.00 NOK / 25µg
Estimated Shipment: 20-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq]

Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
Specifications

Specifications

NP_116147
Liquid
84844
PHF5A (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
RUO
PHF5A
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
INI/MGC1346/SF3b14b/bK223H9.2
PHF5A
Yes
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers