missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PHF1 Partial ORF (NP_077084, 2 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005252-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139031

  • 5420.23 NOK / 25µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Specifications

Specifications

NP_077084
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
RUO
PHF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5252
PHF1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MTF2L2/PCL1/PHF2
PHF1
Yes
Videos
SDS
Documents
Certificates