missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202745

Invitrogen™ Human PDGFRA (aa 54-180) Control Fragment Recombinant Protein

Product Code. 30202745
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202745

Brand: Invitrogen™ RP108186

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDGFRA is a cell surface receptor tyrosine kinase which binds members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P16234
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5156
Name Human PDGFRA (aa 54-180) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI115593; alpha platelet-derived growth factor receptor; Alpha platelet-derived growth factor receptor precursor (PDGF-R-alpha); alpha-type platelet-derived growth factor receptor; APDGFR; CD140 antigen-like family member A; CD140A; CD140a antigen; GAS9; MGC74795; OTTHUMP00000218656; PDGF A-chain; PDGF alpha chain; PDGF Receptor alpha; PDGF subunit A; PDGF-1; PDGFACE; PDGFR2; Pdgfr-2; PDGFRA; pdgfr-a; PDGFRA/BCR fusion; PDGF-R-alpha; PDGFR-alpha; platelet derived growth factor receptor alpha; platelet derived growth factor receptor, alpha polypeptide; platelet-derived growth factor alpha receptor; Platelet-derived growth factor receptor 2; platelet-derived growth factor receptor alpha; platelet-derived growth factor receptor, alpha polypeptide; rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein; RHEPDGFRA
Common Name PDGFRA (CD140a)
Gene Symbol PDGFRA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.