Learn More
Abnova™ Human PCDH21 Partial ORF (NP_149091, 113 a.a. - 211 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00092211-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of the cadherin superfamily of calcium-dependent cell-cell adhesion molecules. The encoded protein has a signal peptide, six cadherin repeat domains and a unique cytoplasmic region. This non-classical cadherin appears to be exclusively expressed in the mitral and tufted cells in the main and accessory olfactory bulbs of the brain, suggesting a possible role in the formation and maintenance of neuronal networks. [provided by RefSeq]
Sequence: GLNLVAEKVVILVTDANDEAPRFIQEPYVALVPEDIPAGSIIFKVHAVDRDTGSGGSVTYFLQNLHSPFAVDRHSGVLRLQAGATLDYERSRTHYITVVSpecifications
NP_149091 | |
Liquid | |
92211 | |
PCDH21 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp434A132/KIAA1775/PRCAD | |
PCDH21 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
GLNLVAEKVVILVTDANDEAPRFIQEPYVALVPEDIPAGSIIFKVHAVDRDTGSGGSVTYFLQNLHSPFAVDRHSGVLRLQAGATLDYERSRTHYITVV | |
RUO | |
PCDH21 | |
Wheat Germ (in vitro) | |
GST |