missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PAPSS1 Partial ORF (NP_005434, 144 a.a. - 252 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009061-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139845

  • 5420.23 NOK / 25µg

Estimated Shipment: 13-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).[supplied by OMIM]

Sequence: QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAE
Specifications

Specifications

NP_005434
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.73kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAE
RUO
PAPSS1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9061
PAPSS1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATPSK1/PAPSS/SK1
PAPSS1
Yes
Videos
SDS
Documents
Certificates