missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human OPA1 Partial ORF (NP_056375, 851 a.a. - 960 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004976-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138581

  • 3602.46 NOK / 10µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
Specifications

Specifications

NP_056375
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
RUO
OPA1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4976
OPA1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ12460/KIAA0567/MGM1/NPG/NTG/largeG
OPA1
Yes
Videos
SDS
Documents
Certificates