Learn More
Abnova™ Human OCRL Partial ORF (NP_000267, 146 a.a. - 239 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004952-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a phosphatase enzyme that is involved in actin polymerization and is found in the trans-Golgi network. Mutations in this gene cause oculocerebrorenal syndrome of Lowe and also Dent disease. [provided by RefSeq]
Sequence: SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQTSpecifications
NP_000267 | |
Liquid | |
4952 | |
OCRL (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
INPP5F/LOCR/NPHL2/OCRL1 | |
OCRL | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.08kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQT | |
RUO | |
OCRL | |
Wheat Germ (in vitro) | |
GST |