Learn More
Abnova™ Human NUDT21 Partial ORF (AAH01403.1, 144 a.a. - 211 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00011051-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq]
Sequence: CIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPISpecifications
AAH01403.1 | |
Liquid | |
11051 | |
NUDT21 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CFIM25/CPSF5/DKFZp686H1588 | |
NUDT21 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.11kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
CIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPI | |
RUO | |
NUDT21 | |
Wheat Germ (in vitro) | |
GST |