missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NT5C Full-length ORF (AAH08183.1, 1 a.a. - 117 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00030833-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Pyrimidine 5-prime nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1; MIM 606224) and type II (UMPH2).[supplied by OMIM]
Sequence: MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKVWLPRPYSARGAASpecifications
| AAH08183.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 39.7kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DNT/DNT1/P5N2/PN-I/PN-II/UMPH2/cdN/dNT-1 | |
| NT5C | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 30833 | |
| NT5C (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKVWLPRPYSARGAA | |
| RUO | |
| NT5C | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |