missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NPL Full-length ORF (AAH58003.1, 1 a.a. - 240 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00080896-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16195063

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

N-acetylneuraminate pyruvate lyase (EC 4.1.3.3) controls the cellular concentration of sialic acid by catalyzing the conversion of sialic acid into acylmannosamines and pyruvate (Wu et al., 2005 [PubMed 16147865]).[supplied by OMIM]

Sequence: MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEFCIQRFINFVVKLENSKLKVSKNQRTLPLGTTNFPFLH
Specifications

Specifications

AAH58003.1
Liquid
80896
NPL (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEFCIQRFINFVVKLENSKLKVSKNQRTLPLGTTNFPFLH
RUO
NPL
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
53.2kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C1orf13/MGC149582/MGC61869/NPL1/c112
NPL
Yes
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers