missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NOXO1 Partial ORF (AAH15917, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00124056-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16191667

  • 3655.00 NOK / 10µg
Estimated Shipment: 28-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

NADPH oxidases (NOXs) catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species (ROS). NOX organizers, such as NOXO1, target NOX activators (see NOXA1; MIM 611255) to NOX and also target NOX to different subcellular compartments (Opitz et al., 2007 [PubMed 17189823]).[supplied by OMIM]

Sequence: MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR
Specifications

Specifications

AAH15917
Liquid
124056
NOXO1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC20258/P41NOX/P41NOXA/P41NOXB/P41NOXC/SH3PXD5/SNX28
NOXO1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAGLLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRR
RUO
NOXO1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers