missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NFATC3 Partial ORF (NP_775188, 70 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004775-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]
Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHLSpecifications
| NP_775188 | |
| Liquid | |
| 4775 | |
| NFATC3 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NFAT4/NFATX | |
| NFATC3 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.54kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL | |
| RUO | |
| NFATC3 | |
| Wheat Germ (in vitro) | |
| GST |