missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NFATC3 Partial ORF (NP_775188, 70 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004775-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138321

  • 3602.46 NOK / 10µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
Specifications

Specifications

NP_775188
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.54kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
RUO
NFATC3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4775
NFATC3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NFAT4/NFATX
NFATC3
Yes
Videos
SDS
Documents
Certificates