Learn More
Abnova™ Human NAV2 Partial ORF (NP_892009.2, 1878 a.a. - 1973 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00089797-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The vitamin A metabolite, all-trans retinoic acid (atRA), plays an important role in neuronal development, including neurite outgrowth. RAINB1 is an atRA-responsive gene.[supplied by OMIM]
Sequence: TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSSpecifications
NP_892009.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.3kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS | |
RUO | |
NAV2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
89797 | |
NAV2 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FLJ10633/FLJ11030/FLJ23707/FLJ77876/HELAD1/KIAA1419/POMFIL2/RAINB1/STEERIN2/UNC53H2 | |
NAV2 | |
Recombinant | |
wheat germ expression system |