Learn More
Abnova™ Human MYL3 Partial ORF (NP_000249.1, 34 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004634-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq]
Sequence: EVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTSpecifications
NP_000249.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.77kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
EVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNT | |
RUO | |
MYL3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
4634 | |
MYL3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CMH8/MLC1SB/MLC1V/VLC1 | |
MYL3 | |
Recombinant | |
wheat germ expression system |