missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MRRF Partial ORF (NP_620132, 163 a.a. - 262 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00092399-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141217

  • 3602.46 NOK / 10µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: RESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG
Specifications

Specifications

NP_620132
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG
RUO
MRRF
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
92399
MRRF (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MRFF/MTRRF/RRF
MRRF
Yes
Videos
SDS
Documents
Certificates