Learn More
Abnova™ Human MOGAT2 Partial ORF (NP_079374, 44 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00080168-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM]
Sequence: TRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGSpecifications
NP_079374 | |
Liquid | |
80168 | |
MOGAT2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DGAT2L5/FLJ22644/MGAT2/MGC119183/MGC119184/MGC119185 | |
MOGAT2 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.67kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAG | |
RUO | |
MOGAT2 | |
Wheat Germ (in vitro) | |
GST |