missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MGC70870 Full-length ORF (NP_982348.1, 1 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00403340-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16140664

  • 3655.00 NOK / 10µg
Estimated Shipment: 21-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MQEIHEKVLNEVVGAMMYHNFSLTREDLENFKALRVIMQVGSGYDNVAIKAAGELEIALCSIPSAAVEETADSTTGHILNLYWGNRSLYQALREGTRVHSVEQIGEVASVKARIRGEILGLIGFGRTQQEVAVRAKAFAGWDRAVPGCA
Specifications

Specifications

NP_982348.1
Liquid
403340
MGC70870 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MQEIHEKVLNEVVGAMMYHNFSLTREDLENFKALRVIMQVGSGYDNVAIKAAGELEIALCSIPSAAVEETADSTTGHILNLYWGNRSLYQALREGTRVHSVEQIGEVASVKARIRGEILGLIGFGRTQQEVAVRAKAFAGWDRAVPGCA
RUO
MGC70870
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
42.7kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC70870
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers