Learn More
Abnova™ Human MAGEA4 Partial ORF (NP_002353, 98 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004103-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene. [provided by RefSeq]
Sequence: TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDSpecifications
NP_002353 | |
Liquid | |
4103 | |
MAGEA4 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MAGE-41/MAGE-X2/MAGE4/MAGE4A/MAGE4B/MGC21336 | |
MAGEA4 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.88kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD | |
RUO | |
MAGEA4 | |
Wheat Germ (in vitro) | |
GST |