missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MAFB Partial ORF (NP_005452.2, 1 a.a. - 53 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009935-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141476

  • 5420.23 NOK / 25µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. [provided by RefSeq]

Sequence: MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAG
Specifications

Specifications

NP_005452.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.57kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAG
RUO
MAFB
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9935
MAFB (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KRML/MGC43127
MAFB
Yes
Videos
SDS
Documents
Certificates