missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LOC201181 Full-length ORF (NP_001013646.1, 1 a.a. - 174 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human LOC201181 Full-length ORF (NP_001013646.1, 1 a.a. - 174 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16139273
Price: 6245.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00201181-P01.25ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16139273

6245.00 NOK / 25µg

Estimated Shipment: 03-07-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVNSETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAARFLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLAPY

Specifications

Accession Number	NP_001013646.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	44.6kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	ZNF385C
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	201181
Name	LOC201181 (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVNSETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAARFLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLAPY
Regulatory Status	RUO
Gene Symbol	ZNF385C
Recombinant	Recombinant
Expression System	wheat germ expression system

Product Suggestions

Abnova™ Human LOC201181 Full-length ORF (NP_001013646.1, 1 a.a. - 174 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers