missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KRTHA6 Partial ORF (NP_003762.1, 368 a.a. - 467 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008689-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16189045

  • 4115.00 NOK / 10µg
Estimated Shipment: 19-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the keratin gene family. This type I hair keratin is an acidic protein which heterodimerizes with type II keratins to form hair and nails. The type I hair keratins are clustered in a region of chromosome 17q12-q21 and have the same direction of transcription. [provided by RefSeq]

Sequence: DLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL
Specifications

Specifications

NP_003762.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVPSVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL
RUO
KRT36
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
8689
KRTHA6 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HA6/KRTHA6/hHa6
KRT36
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers